Paralogue Annotation for RYR1 residue 3414

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3414
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3414

No paralogue variants have been mapped to residue 3414 for RYR1.



RYR1KAEAQEGELLVRDEFSVLCRDLYALYPLLI>R<YVDNNRAQWLTEPNPSAEELFRMVGEIFIY3444
RYR2RGDMSEAELLILDEFTTLARDLYAFYPLLI>R<FVDYNRAKWLKEPNPEAEELFRMVAEVFIY3405
RYR3KGDTQEAELLILDEFAVLCRDLYAFYPMLI>R<YVDNNRSNWLKSPDADSDQLFRMVAEVFIL3301
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3414Cc.10240C>T Putative BenignSIFT:
Polyphen: possibly damaging
p.R3414Hc.10241G>A Putative BenignSIFT:
Polyphen: benign