Paralogue Annotation for RYR1 residue 3448

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3448
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3448

No paralogue variants have been mapped to residue 3448 for RYR1.



RYR1NNRAQWLTEPNPSAEELFRMVGEIFIYWSK>S<HNFKREEQNFVVQNEINNMSFLTADNKSKM3478
RYR2YNRAKWLKEPNPEAEELFRMVAEVFIYWSK>S<HNFKREEQNFVVQNEINNMSFLITDTKSKM3439
RYR3NNRSNWLKSPDADSDQLFRMVAEVFILWCK>S<HNFKREEQNFVIQNEINNLAFLTGDSKSKM3335
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3448Fc.10343C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Minicore myopathy with ophthalmoplegia caused by mutations in the ryanodine receptor type 1 gene. Neurology. 2005 65(12):1930-5. 16380615