Paralogue Annotation for RYR1 residue 3452

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3452
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3452

No paralogue variants have been mapped to residue 3452 for RYR1.



RYR1QWLTEPNPSAEELFRMVGEIFIYWSKSHNF>K<REEQNFVVQNEINNMSFLTADNKSKMAKAG3482
RYR2KWLKEPNPEAEELFRMVAEVFIYWSKSHNF>K<REEQNFVVQNEINNMSFLITDTKSKMSKAA3443
RYR3NWLKSPDADSDQLFRMVAEVFILWCKSHNF>K<REEQNFVIQNEINNLAFLTGDSKSKMSKAM3339
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K3452Qc.10354A>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy A novel late-onset axial myopathy associated with mutations in the skeletal muscle ryanodine receptor (RYR1) gene. J Neurol. 2013 23329375