Paralogue Annotation for RYR1 residue 3481

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3481
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3481

No paralogue variants have been mapped to residue 3481 for RYR1.



RYR1FKREEQNFVVQNEINNMSFLTADNKSKMAK>A<GDIQSGGSDQERTKKKRRGDRYSVQTSLIV3511
RYR2FKREEQNFVVQNEINNMSFLITDTKSKMSK>A<A-----VSDQERKKMKRKGDRYSMQTSLIV3467
RYR3FKREEQNFVIQNEINNLAFLTGDSKSKMSK>A<MQVKSGGQDQERKKTKRRGDLYSIQTSLIV3368
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3481Vc.10442C>T Putative BenignSIFT: tolerated
Polyphen: benign