Paralogue Annotation for RYR1 residue 3527

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3527
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3527

No paralogue variants have been mapped to residue 3527 for RYR1.



RYR1KRRGDRYSVQTSLIVATLKKMLPIGLNMCA>P<TDQDLITLAKTRYALKDTDEEVREFLHNNL3557
RYR2KRKGDRYSMQTSLIVAALKRLLPIGLNICA>P<GDQELIALAKNRFSLKDTEDEVRDIIRSNI3513
RYR3KRRGDLYSIQTSLIVAALKKMLPIGLNMCT>P<GDQELISLAKSRYSHRDTDEEVREHLRNNL3414
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P3527Sc.10579C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy A recessive form of central core disease, transiently presenting as multi-minicore disease, is associated with a homozygous mutation in the ryanodine receptor type 1 gene. Ann Neurol. 2002 51(6):750-9. 12112081