Paralogue Annotation for RYR1 residue 3534

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3534
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3534

No paralogue variants have been mapped to residue 3534 for RYR1.



RYR1SVQTSLIVATLKKMLPIGLNMCAPTDQDLI>T<LAKTRYALKDTDEEVREFLHNNLHLQGKVE3564
RYR2SMQTSLIVAALKRLLPIGLNICAPGDQELI>A<LAKNRFSLKDTEDEVRDIIRSNIHLQGKLE3520
RYR3SIQTSLIVAALKKMLPIGLNMCTPGDQELI>S<LAKSRYSHRDTDEEVREHLRNNLHLQEKSD3421
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3534Mc.10601C>T Putative BenignSIFT:
Polyphen: benign