Paralogue Annotation for RYR1 residue 3581

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3581
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3581

No paralogue variants have been mapped to residue 3581 for RYR1.



RYR1EFLHNNLHLQGKVEGSPSLRWQMALYRGVP>G<REEDADDPEKIVRRV-------------QE3598
RYR2DIIRSNIHLQGKLE-DPAIRWQMALYKDLP>N<RTDDTSDPEKTVERVLDIANVLFHLEQKSK3566
RYR3EHLRNNLHLQEKSD-DPAVKWQLNLYKDVL>K<-SEEPFNPEKTVERV-------------QR3453
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3581Dc.10742G>A Putative BenignSIFT:
Polyphen: benign