Paralogue Annotation for RYR1 residue 360

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 360
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 360

No paralogue variants have been mapped to residue 360 for RYR1.



RYR1VEGMGPPEIKYGESLCFVQHVASGLWLTYA>A<PDPKALRLGVLKKKAMLHQEGHMDDALSLT390
RYR2VDGMGTSEIKYGDSVCYIQHVDTGLWLTYQ>S<VDVKSVRMGSIQRKAIMHHEGHMDDGISLS406
RYR3IEGMGVPEIKYGDSVCFVQHIASGLWVTYK>A<QDAKTSRLGPLKRKVILHQEGHMDDGLTLQ398
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A360Tc.1078G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging