Paralogue Annotation for RYR1 residue 363

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 363
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 363

No paralogue variants have been mapped to residue 363 for RYR1.



RYR1MGPPEIKYGESLCFVQHVASGLWLTYAAPD>P<KALRLGVLKKKAMLHQEGHMDDALSLTRCQ393
RYR2MGTSEIKYGDSVCYIQHVDTGLWLTYQSVD>V<KSVRMGSIQRKAIMHHEGHMDDGISLSRSQ409
RYR3MGVPEIKYGDSVCFVQHIASGLWVTYKAQD>A<KTSRLGPLKRKVILHQEGHMDDGLTLQRCQ401
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P363Sc.1087C>T Putative BenignSIFT: tolerated
Polyphen: benign