Paralogue Annotation for RYR1 residue 3815

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3815
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3815

No paralogue variants have been mapped to residue 3815 for RYR1.



RYR1CKGETGAMVSSTLKLGISILNGGNAEVQQK>M<LDYLKDKKEVGFFQSIQALMQTCSVLDLNA3845
RYR2SKGETGPMVAATLKLGIAILNGGNSTVQQK>M<LDYLKEKKDVGFFQSLAGLMQSCSVLDLNA3807
RYR3SKGEMSPMVVETLKLGIAILNGGNAGVQQK>M<LDYLKEKKDAGFFQSLSGLMQSCSVLDLNA3697
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M3815Lc.11443A>T Putative BenignSIFT: tolerated
Polyphen: benign