Paralogue Annotation for RYR1 residue 3839

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3839
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3839

No paralogue variants have been mapped to residue 3839 for RYR1.



RYR1AEVQQKMLDYLKDKKEVGFFQSIQALMQTC>S<VLDLNAFERQNKAEGLGMVNEDGTVINRQN3869
RYR2STVQQKMLDYLKEKKDVGFFQSLAGLMQSC>S<VLDLNAFERQNKAEGLGMVTEEGS------3825
RYR3AGVQQKMLDYLKEKKDAGFFQSLSGLMQSC>S<VLDLNAFERQNKAEGLGMVTEEGTLIVRER3721
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3839Ic.11516G>T Putative BenignSIFT: deleterious
Polyphen: benign