Paralogue Annotation for RYR1 residue 3848

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3848
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3848

No paralogue variants have been mapped to residue 3848 for RYR1.



RYR1YLKDKKEVGFFQSIQALMQTCSVLDLNAFE>R<QNKAEGLGMVNEDGTVINRQNGEKVMADDE3878
RYR2YLKEKKDVGFFQSLAGLMQSCSVLDLNAFE>R<QNKAEGLGMVTEEGS------GEKVLQDDE3834
RYR3YLKEKKDAGFFQSLSGLMQSCSVLDLNAFE>R<QNKAEGLGMVTEEGTLIVRERGEKVLQNDE3730
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3848Kc.11543G>A Putative BenignSIFT:
Polyphen: benign