Paralogue Annotation for RYR1 residue 3853

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3853
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3853

No paralogue variants have been mapped to residue 3853 for RYR1.



RYR1KEVGFFQSIQALMQTCSVLDLNAFERQNKA>E<GLGMVNEDGTVINRQNGEKVMADDEFTQDL3883
RYR2KDVGFFQSLAGLMQSCSVLDLNAFERQNKA>E<GLGMVTEEGS------GEKVLQDDEFTCDL3839
RYR3KDAGFFQSLSGLMQSCSVLDLNAFERQNKA>E<GLGMVTEEGTLIVRERGEKVLQNDEFTRDL3735
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3853Kc.11557G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Next generation sequencing for molecular diagnosis of neuromuscular diseases. Acta Neuropathol. 2012 124(2):273-83. 22526018
Other Myopathy Using exome data to identify malignant hyperthermia susceptibility mutations. Anesthesiology. 2013 119(5):1043-53. doi: 10.1097/ALN.0b013e3182a8a8e7. 24195946
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381