Paralogue Annotation for RYR1 residue 3893

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3893
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3893

No paralogue variants have been mapped to residue 3893 for RYR1.



RYR1TVINRQNGEKVMADDEFTQDLFRFLQLLCE>G<HNNDFQNYLRTQTGNTTTINIIICTVDYLL3923
RYR2S------GEKVLQDDEFTCDLFRFLQLLCE>G<HNSDFQNYLRTQTGNNTTVNIIISTVDYLL3879
RYR3TLIVRERGEKVLQNDEFTRDLFRFLQLLCE>G<HNSDFQNFLRTQMGNTTTVNVIISTVDYLL3775
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3893Ec.11678G>A Putative BenignSIFT: deleterious
Polyphen: benign