Paralogue Annotation for RYR1 residue 39

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 39
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 39

No paralogue variants have been mapped to residue 39 for RYR1.



RYR1EVQFLRTDDEVVLQCSATVLKEQLKLCLAA>E<GFGNRLCFLEPTSNAQNVPPDLAICCFVLE69
RYR2EIQFLRTDDEVVLQCTATIHKEQQKLCLAA>E<GFGNRLCFLESTSNSKNVPPDLSICTFVLE70
RYR3EIQFLRTEDEVVLQCIATIHKEQRKFCLAA>E<GLGNRLCFLEPTSEAKYIPPDLCVCNFVLE71
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E39Kc.115G>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging