Paralogue Annotation for RYR1 residue 3908

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3908
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3908

No paralogue variants have been mapped to residue 3908 for RYR1.



RYR1EFTQDLFRFLQLLCEGHNNDFQNYLRTQTG>N<TTTINIIICTVDYLLRLQESISDFYWYYSG3938
RYR2EFTCDLFRFLQLLCEGHNSDFQNYLRTQTG>N<NTTVNIIISTVDYLLRVQESISDFYWYYSG3894
RYR3EFTRDLFRFLQLLCEGHNSDFQNFLRTQMG>N<TTTVNVIISTVDYLLRLQESISDFYWYYSG3790
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3908Ic.11723A>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Functional and genetic characterization of clinical malignant hyperthermia crises: a multi-centre study. Orphanet J Rare Dis. 2014 9(1):8. doi: 10.1186/1750-1172-9-8. 24433488
p.N3908Sc.11723A>G Putative BenignSIFT:
Polyphen: benign