Paralogue Annotation for RYR1 residue 4010

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4010
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4010

No paralogue variants have been mapped to residue 4010 for RYR1.



RYR1AHSRLWDAVVGFLHVFAHMMMKLAQDSSQI>E<LLKELLDLQKDMVVMLLSLLEGNVVNGMIA4040
RYR2AHSRLWDAVVGFLHVFAHMQMKLSQDSSQI>E<LLKELMDLQKDMVVMLLSMLEGNVVNGTIG3996
RYR3AHSRLWDAVVGFLHVFANMQMKLSQDSSQI>E<LLKELLDLLQDMVVMLLSLLEGNVVNGTIG3892
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E4010Kc.12028G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Next-generation Sequencing of RYR1 and CACNA1S in Malignant Hyperthermia and Exertional Heat Illness. Anesthesiology. 2015 122(5):1033-46. doi: 10.1097/ALN.0000000000000610. 25658027