Paralogue Annotation for RYR1 residue 402

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 402
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 402

No paralogue variants have been mapped to residue 402 for RYR1.



RYR1KKKAMLHQEGHMDDALSLTRCQQEESQAAR>M<IHSTNGLYNQFIKSLDSFSGKPRGSGPPAG432
RYR2QRKAIMHHEGHMDDGISLSRSQHEESRTAR>V<IRSTVFLFNRFIRGLDALSKKAKA----ST444
RYR3KRKVILHQEGHMDDGLTLQRCQREESQAAR>I<IRNTTALFSQFVSGN-----NRTA----AP431
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M402Tc.1205T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Molecular mechanisms and phenotypic variation in RYR1-related congenital myopathies. Brain. 2007 130(Pt 8):2024-36. 17483490
Other Myopathy Recessive mutations in RYR1 are a common cause of congenital fiber type disproportion. Hum Mutat. 2010 31(7):E1544-50. 20583297
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146
Unknown 20301436
p.M402Vc.1204A>G Putative BenignSIFT:
Polyphen: