Paralogue Annotation for RYR1 residue 404

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 404
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 404

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2R420WVentricular tachycardia, polymorphicMedium9 12106942, 22373669, 22374134, 24025405, 25193700, 27114410, 26332594
RYR2R420QCatecholaminergic polymorphic ventricular tachycarMedium9 19926015, 23871484, 24025405, 25440180, 25440180

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1KAMLHQEGHMDDALSLTRCQQEESQAARMI>H<STNGLYNQFIKSLDSFSGKPRGSGPPAGTA434
RYR2KAIMHHEGHMDDGISLSRSQHEESRTARVI>R<STVFLFNRFIRGLDALSKKAKA----STVD446
RYR3KVILHQEGHMDDGLTLQRCQREESQAARII>R<NTTALFSQFVSGN-----NRTA----APIT433
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H404Rc.1211A>G Putative BenignSIFT: tolerated
Polyphen: benign
p.H404Yc.1210C>T Putative BenignSIFT:
Polyphen: