Paralogue Annotation for RYR1 residue 407

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 407
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 407

No paralogue variants have been mapped to residue 407 for RYR1.



RYR1LHQEGHMDDALSLTRCQQEESQAARMIHST>N<GLYNQFIKSLDSFSGKPRGSGPPAGTALPI437
RYR2MHHEGHMDDGISLSRSQHEESRTARVIRST>V<FLFNRFIRGLDALSKKAKA----STVDLPI449
RYR3LHQEGHMDDGLTLQRCQREESQAARIIRNT>T<ALFSQFVSGN-----NRTA----APITLPI436
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N407Sc.1220A>G Putative BenignSIFT:
Polyphen: benign