Paralogue Annotation for RYR1 residue 41

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 41
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 41

No paralogue variants have been mapped to residue 41 for RYR1.



RYR1QFLRTDDEVVLQCSATVLKEQLKLCLAAEG>F<GNRLCFLEPTSNAQNVPPDLAICCFVLEQS71
RYR2QFLRTDDEVVLQCTATIHKEQQKLCLAAEG>F<GNRLCFLESTSNSKNVPPDLSICTFVLEQS72
RYR3QFLRTEDEVVLQCIATIHKEQRKFCLAAEG>L<GNRLCFLEPTSEAKYIPPDLCVCNFVLEQS73
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F41Sc.122T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Muscle magnetic resonance imaging in congenital myopathies due to ryanodine receptor type 1 gene mutations. Arch Neurol. 2011 68(9):1171-9. 21911697