Paralogue Annotation for RYR1 residue 4119

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4119
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4119

No paralogue variants have been mapped to residue 4119 for RYR1.



RYR1KKDFQKAMDSQKQFSGPEIQFLLSCSEADE>N<EMINCEEFANRFQEPARDIGFNVAVLLTNL4149
RYR2KRDFHKAMESHKHYTQSETEFLLSCAETDE>N<ETLDYEEFVKRFHEPAKDIGFNVAVLLTNL4105
RYR3KKEFQKAMEGQKQYTQSEIDFLLSCAEADE>N<DMFNYVDFVDRFHEPAKDIGFNVAVLLTNL4001
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N4119Yc.12355A>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Screening of the entire ryanodine receptor type 1 coding region for sequence variants associated with malignant hyperthermia susceptibility in the north american population. Anesthesiology. 2005 102(3):515-21. 15731587
p.N4119Ic.12356A>T Putative BenignSIFT: deleterious
Polyphen: benign