Paralogue Annotation for RYR1 residue 4136

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4136
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4136

No paralogue variants have been mapped to residue 4136 for RYR1.



RYR1EIQFLLSCSEADENEMINCEEFANRFQEPA>R<DIGFNVAVLLTNLSEHVPHDPRLHNFLELA4166
RYR2ETEFLLSCAETDENETLDYEEFVKRFHEPA>K<DIGFNVAVLLTNLSEHMPNDTRLQTFLELA4122
RYR3EIDFLLSCAEADENDMFNYVDFVDRFHEPA>K<DIGFNVAVLLTNLSEHMPNDSRLKCLLDPA4018
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4136Sc.12406C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in the RYR1 gene in Italian patients at risk for malignant hyperthermia: evidence for a cluster of novel mutations in the C-terminal region. Cell Calcium. 2002 32(3):143-51. 12208234
p.R4136Hc.12407G>A Putative BenignSIFT: deleterious
Polyphen: benign