Paralogue Annotation for RYR1 residue 4150

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4150
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4150

No paralogue variants have been mapped to residue 4150 for RYR1.



RYR1EMINCEEFANRFQEPARDIGFNVAVLLTNL>S<EHVPHDPRLHNFLELAESILEYFRPYLGRI4180
RYR2ETLDYEEFVKRFHEPAKDIGFNVAVLLTNL>S<EHMPNDTRLQTFLELAESVLNYFQPFLGRI4136
RYR3DMFNYVDFVDRFHEPAKDIGFNVAVLLTNL>S<EHMPNDSRLKCLLDPAESVLNYFEPYLGRI4032
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S4150Wc.12449C>G Putative Benignrs143843083SIFT:
Polyphen: possibly damaging