Paralogue Annotation for RYR1 residue 4178

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4178
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4178

No paralogue variants have been mapped to residue 4178 for RYR1.



RYR1NLSEHVPHDPRLHNFLELAESILEYFRPYL>G<RIEIMGASRRIERIYFEISETNRAQWEMPQ4208
RYR2NLSEHMPNDTRLQTFLELAESVLNYFQPFL>G<RIEIMGSAKRIERVYFEISESSRTQWEKPQ4164
RYR3NLSEHMPNDSRLKCLLDPAESVLNYFEPYL>G<RIEIMGGAKKIERVYFEISESSRTQWEKPQ4060
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G4178Sc.12532G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Functional and genetic characterization of clinical malignant hyperthermia crises: a multi-centre study. Orphanet J Rare Dis. 2014 9(1):8. doi: 10.1186/1750-1172-9-8. 24433488