Paralogue Annotation for RYR1 residue 4210

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4210
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4210

No paralogue variants have been mapped to residue 4210 for RYR1.



RYR1IEIMGASRRIERIYFEISETNRAQWEMPQV>K<ESKRQFIFDVVNEGGEAEKMELFVSFCEDT4240
RYR2IEIMGSAKRIERVYFEISESSRTQWEKPQV>K<ESKRQFIFDVVNEGGEKEKMELFVNFCEDT4196
RYR3IEIMGGAKKIERVYFEISESSRTQWEKPQV>K<ESKRQFIFDVVNEGGEQEKMELFVNFCEDT4092
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K4210Rc.12629A>G Other MyopathySIFT:
Polyphen: benign
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145