Paralogue Annotation for RYR1 residue 4286

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4286
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4286

No paralogue variants have been mapped to residue 4286 for RYR1.



RYR1EPETDEDEGAGAAEAGAEGAEEGAAGLEGT>A<ATAAAGATARVVAAAGRALRGLSYRSLRRR4316
RYR2NERSANKEESEK-----ERPEEQGPRMAFF>S<ILTVRSALFALRYNILTLMRMLSLKSLKKQ4267
RYR3ADRPEEEEEDEDSSYVLEIAGEEEEDGSLE>P<ASAFAMACASVKRNVTDFLKRATLKNLRKQ4168
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4286Ec.12857C>A Putative BenignSIFT:
Polyphen: benign