Paralogue Annotation for RYR1 residue 4291

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4291
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4291

No paralogue variants have been mapped to residue 4291 for RYR1.



RYR1EDEGAGAAEAGAEGAEEGAAGLEGTAATAA>A<GATARVVAAAGRALRGLSYRSLRRRVRRLR4321
RYR2NKEESEK-----ERPEEQGPRMAFFSILTV>R<SALFALRYNILTLMRMLSLKSLKKQMKKVK4272
RYR3EEEEDEDSSYVLEIAGEEEEDGSLEPASAF>A<MACASVKRNVTDFLKRATLKNLRKQYRNVK4173
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4291Gc.12872C>G UnknownSIFT:
Polyphen: benign