Paralogue Annotation for RYR1 residue 4293

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4293
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4293

No paralogue variants have been mapped to residue 4293 for RYR1.



RYR1EGAGAAEAGAEGAEEGAAGLEGTAATAAAG>A<TARVVAAAGRALRGLSYRSLRRRVRRLRRL4323
RYR2EESEK-----ERPEEQGPRMAFFSILTVRS>A<LFALRYNILTLMRMLSLKSLKKQMKKVKKM4274
RYR3EEDEDSSYVLEIAGEEEEDGSLEPASAFAM>A<CASVKRNVTDFLKRATLKNLRKQYRNVKKM4175
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4293Ec.12878C>A Putative BenignSIFT:
Polyphen: benign
p.A4293Vc.12878C>T Putative BenignSIFT:
Polyphen: benign