Paralogue Annotation for RYR1 residue 4296

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4296
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4296

No paralogue variants have been mapped to residue 4296 for RYR1.



RYR1GAAEAGAEGAEEGAAGLEGTAATAAAGATA>R<VVAAAGRALRGLSYRSLRRRVRRLRRLTAR4326
RYR2EK-----ERPEEQGPRMAFFSILTVRSALF>A<LRYNILTLMRMLSLKSLKKQMKKVKKMTVK4277
RYR3EDSSYVLEIAGEEEEDGSLEPASAFAMACA>S<VKRNVTDFLKRATLKNLRKQYRNVKKMTAK4178
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4296Wc.12886C>T UnknownSIFT:
Polyphen: benign