Paralogue Annotation for RYR1 residue 4331

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4331
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4331

No paralogue variants have been mapped to residue 4331 for RYR1.



RYR1AGRALRGLSYRSLRRRVRRLRRLTAREAAT>A<VAALLWAAVTRAGAAGAGAAAGALGLLWGS4361
RYR2ILTLMRMLSLKSLKKQMKKVKKMTVKDMVT>A<FFSSYWSIFMTLLHFVASVFRGFFRIICSL4312
RYR3VTDFLKRATLKNLRKQYRNVKKMTAKELVK>V<LFSFFWMLFVGLFQLLFTILGGIFQILWST4213
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4331Tc.12991G>A Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Next-generation Sequencing of RYR1 and CACNA1S in Malignant Hyperthermia and Exertional Heat Illness. Anesthesiology. 2015 122(5):1033-46. doi: 10.1097/ALN.0000000000000610. 25658027