Paralogue Annotation for RYR1 residue 4345

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4345
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4345

No paralogue variants have been mapped to residue 4345 for RYR1.



RYR1RRVRRLRRLTAREAATAVAALLWAAVTRAG>A<AGAGAAAGALGLLWGSLFGGGLVEGAKKVT4375
RYR2KQMKKVKKMTVKDMVTAFFSSYWSIFMTLL>H<FVASVFRGFFRIICSLLLGGSLVEGAKKIK4326
RYR3KQYRNVKKMTAKELVKVLFSFFWMLFVGLF>Q<LLFTILGGIFQILWSTVFGGGLVEGAKNIR4227
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4345Pc.13033G>C Putative BenignSIFT:
Polyphen: benign