Paralogue Annotation for RYR1 residue 4353

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4353
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4353

No paralogue variants have been mapped to residue 4353 for RYR1.



RYR1LTAREAATAVAALLWAAVTRAGAAGAGAAA>G<ALGLLWGSLFGGGLVEGAKKVTVTELLAGM4383
RYR2MTVKDMVTAFFSSYWSIFMTLLHFVASVFR>G<FFRIICSLLLGGSLVEGAKKIKVAELLANM4334
RYR3MTAKELVKVLFSFFWMLFVGLFQLLFTILG>G<IFQILWSTVFGGGLVEGAKNIRVTKILGDM4235
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G4353Dc.13058G>A Putative BenignSIFT: tolerated
Polyphen: benign