Paralogue Annotation for RYR1 residue 4587

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4587
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4587

No paralogue variants have been mapped to residue 4587 for RYR1.



RYR1SRNFYTLRFLALFLAFAINFILLFYKVSDS>P<PGEDDMEGSAAGDVSGAGSGGSSGW-GLGA4616
RYR2ARNFYNMRMLALFVAFAINFILLFYKVSTS>S<VVEGKE------LPTRSSSENAK-VTSLDS4549
RYR3ARNFYNLRFLALFVAFAINFILLFYKVTEE>P<LEEETE------DVANLWN-------SFND4454
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P4587Lc.13760C>T Other MyopathySIFT:
Polyphen:
ReportsUnknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381