Paralogue Annotation for RYR1 residue 4635

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4635
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4635

No paralogue variants have been mapped to residue 4635 for RYR1.



RYR1SGGSSGW-GLGAGEEAEGDEDENMVYYFLE>E<STGYMEPALRCLSLLHTLVAFLCIIGYNCL4665
RYR2SENAK-VTSLDS-----SSHRIIAVHYVLE>E<SSGYMEPTLRILAILHTVISFFCIIGYYCL4593
RYR3N-------SFND-----EEEEEAMVFFVLQ>E<STGYMAPTLRALAIIHTIISLVCVVGYYCL4498
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E4635Qc.13903G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Clinical and genetic findings in a large cohort of patients with ryanodine receptor 1 gene-associated myopathies. Hum Mutat. 2012 33(6):981-8. doi: 10.1002/humu.22056. 22473935