Paralogue Annotation for RYR1 residue 4647

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4647
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4647

No paralogue variants have been mapped to residue 4647 for RYR1.



RYR1GEEAEGDEDENMVYYFLEESTGYMEPALRC>L<SLLHTLVAFLCIIGYNCLKVPLVIFKREKE4677
RYR2-----SSHRIIAVHYVLEESSGYMEPTLRI>L<AILHTVISFFCIIGYYCLKVPLVIFKREKE4605
RYR3-----EEEEEAMVFFVLQESTGYMAPTLRA>L<AIIHTIISLVCVVGYYCLKVPLVVFKREKE4510
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4647Pc.13940T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Novel excitation-contraction uncoupled RYR1 mutations in patients with central core disease. Neuromuscul Disord. 2013 23(2):120-32. doi: 10.1016/j.nmd.2012.08.007. 23183335