Paralogue Annotation for RYR1 residue 4666

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4666
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4666

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2K4594RVentricular fibrillation, idiopathicHigh9 24950728
RYR2K4594QLong QT syndromeHigh9 26132555

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1STGYMEPALRCLSLLHTLVAFLCIIGYNCL>K<VPLVIFKREKELARKLEFDGLYITEQPEDD4696
RYR2SSGYMEPTLRILAILHTVISFFCIIGYYCL>K<VPLVIFKREKEVARKLEFDGLYITEQPSED4624
RYR3STGYMAPTLRALAIIHTIISLVCVVGYYCL>K<VPLVVFKREKEIARKLEFDGLYITEQPSED4529
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 4666 for RYR1.