Paralogue Annotation for RYR1 residue 4684

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4684
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4684

No paralogue variants have been mapped to residue 4684 for RYR1.



RYR1VAFLCIIGYNCLKVPLVIFKREKELARKLE>F<DGLYITEQPEDDDVKGQWDRLVLNTPSFPS4714
RYR2ISFFCIIGYYCLKVPLVIFKREKEVARKLE>F<DGLYITEQPSEDDIKGQWDRLVINTQSFPN4642
RYR3ISLVCVVGYYCLKVPLVVFKREKEIARKLE>F<DGLYITEQPSEDDIKGQWDRLVINTPSFPN4547
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F4684Sc.14051T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Correlations between genotype and pharmacological, histological, functional, and clinical phenotypes in malignant hyperthermia susceptibility. Hum Mutat. 2005 26(5):413-25. 16163667