Paralogue Annotation for RYR1 residue 4737

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4737
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4737

No paralogue variants have been mapped to residue 4737 for RYR1.



RYR1LNTPSFPSNYWDKFVKRKVLDKHGDIYGRE>R<IAELLGMDLATLEITAHNER-KPNPPPGLL4766
RYR2INTQSFPNNYWDKFVKRKVMDKYGEFYGRD>R<ISELLGMDKAALDFSDAREKKKPKKDSSLS4695
RYR3INTPSFPNNYWDKFVKRKVINKYGDLYGAE>R<IAELLGLDKNALDFSPVEET-KA-EAASLV4598
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4737Qc.14210G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Correlations between genotype and pharmacological, histological, functional, and clinical phenotypes in malignant hyperthermia susceptibility. Hum Mutat. 2005 26(5):413-25. 16163667
Other Myopathy Genetic variation in RYR1 and malignant hyperthermia phenotypes. Br J Anaesth. 2009 103(4):538-48. doi: 10.1093/bja/aep204. 19648156
p.R4737Wc.14209C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in the RYR1 gene in Italian patients at risk for malignant hyperthermia: evidence for a cluster of novel mutations in the C-terminal region. Cell Calcium. 2002 32(3):143-51. 12208234
Other Myopathy Functional characterization of the RYR1 mutation p.Arg4737Trp associated with susceptibility to malignant hyperthermia. Neuromuscul Disord. 2016 26(1):21-5. doi: 10.1016/j.nmd.2015.11.001. 26631338