Paralogue Annotation for RYR1 residue 4820

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4820
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4820

No paralogue variants have been mapped to residue 4820 for RYR1.



RYR1FLYLGWYMVMSLLGHYNNFFFAAHLLDIAM>G<VKTLRTILSSVTHNGKQLVMTVGLLAVVVY4850
RYR2FLYLAWYMTMSVLGHYNNFFFAAHLLDIAM>G<FKTLRTILSSVTHNGKQLVLTVGLLAVVVY4779
RYR3FLYLAWYTTMSVLGHYNNFFFAAHLLDIAM>G<FKTLRTILSSVTHNGKQLVLTVGLLAVVVY4682
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G4820Wc.14458G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943