Paralogue Annotation for RYR1 residue 4824

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4824
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4824

No paralogue variants have been mapped to residue 4824 for RYR1.



RYR1GWYMVMSLLGHYNNFFFAAHLLDIAMGVKT>L<RTILSSVTHNGKQLVMTVGLLAVVVYLYTV4854
RYR2AWYMTMSVLGHYNNFFFAAHLLDIAMGFKT>L<RTILSSVTHNGKQLVLTVGLLAVVVYLYTV4783
RYR3AWYTTMSVLGHYNNFFFAAHLLDIAMGFKT>L<RTILSSVTHNGKQLVLTVGLLAVVVYLYTV4686
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4824Pc.14471T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1 mutations in UK central core disease patients: more than just the C-terminal transmembrane region of the RYR1 gene. J Med Genet. 2004 41(3):e33. 14985404