Paralogue Annotation for RYR1 residue 4825

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4825
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4825

No paralogue variants have been mapped to residue 4825 for RYR1.



RYR1WYMVMSLLGHYNNFFFAAHLLDIAMGVKTL>R<TILSSVTHNGKQLVMTVGLLAVVVYLYTVV4855
RYR2WYMTMSVLGHYNNFFFAAHLLDIAMGFKTL>R<TILSSVTHNGKQLVLTVGLLAVVVYLYTVV4784
RYR3WYTTMSVLGHYNNFFFAAHLLDIAMGFKTL>R<TILSSVTHNGKQLVLTVGLLAVVVYLYTVV4687
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4825Pc.14474G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943
p.R4825Cc.14473C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Familial and sporadic forms of central core disease are associated with mutations in the C-terminal domain of the skeletal muscle ryanodine receptor. Hum Mol Genet. 2001 10(22):2581-92. 11709545
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146
p.R4825Hc.14474G>A Putative BenignSIFT:
Polyphen:
p.R4825Sc.14473C>A Putative BenignSIFT:
Polyphen: