Paralogue Annotation for RYR1 residue 4842
Residue details
Gene: RYR1Reference Sequences: Ensembl variant:
ENST00000359596 /
ENSP00000352608Amino Acid Position: 4842
Reference Amino Acid: V - Valine
Protein Domain: Paralogue Variants mapped to RYR1 residue 4842
To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to
check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing.
It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.
| RYR1 | AHLLDIAMGVKTLRTILSSVTHNGKQLVMT>V<GLLAVVVYLYTVVAFNFFRKFYNKSEDEDE | 4872 |
| RYR2 | AHLLDIAMGFKTLRTILSSVTHNGKQLVLT>V<GLLAVVVYLYTVVAFNFFRKFYNKSEDGDT | 4801 |
| RYR3 | AHLLDIAMGFKTLRTILSSVTHNGKQLVLT>V<GLLAVVVYLYTVVAFNFFRKFYNKSEDDDE | 4704 |
| cons | > < | |
Known Variants in RYR1
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|
| p.V4842M | c.14524G>A |
Other Myopathy | | rs193922879 | SIFT: Polyphen: |
| Reports | Other Myopathy | |
Null mutations causing depletion of the type 1 ryanodine receptor (RYR1) are commonly associated with recessive structural congenital myopathies with cores. Hum Mutat. 2008 29(5):670-8.
18253926 |
| Other Myopathy | |
RyR1 deficiency in congenital myopathies disrupts excitation-contraction coupling. Hum Mutat. 2013 34(7):986-96. doi: 10.1002/humu.22326.
23553787 |
| Unknown | |
Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114.
25637381 |