Paralogue Annotation for RYR1 residue 4855

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4855
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4855

No paralogue variants have been mapped to residue 4855 for RYR1.



RYR1RTILSSVTHNGKQLVMTVGLLAVVVYLYTV>V<AFNFFRKFYNKSEDEDEPDMKCDDMMTCYL4885
RYR2RTILSSVTHNGKQLVLTVGLLAVVVYLYTV>V<AFNFFRKFYNKSEDGDTPDMKCDDMLTCYM4814
RYR3RTILSSVTHNGKQLVLTVGLLAVVVYLYTV>V<AFNFFRKFYNKSEDDDEPDMKCDDMMTCYL4717
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V4855Lc.14563G>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging