Paralogue Annotation for RYR1 residue 4886

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4886
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4886

No paralogue variants have been mapped to residue 4886 for RYR1.



RYR1AFNFFRKFYNKSEDEDEPDMKCDDMMTCYL>F<HMYVGVRAGGGIGDEIEDPAGDEYELYRVV4916
RYR2AFNFFRKFYNKSEDGDTPDMKCDDMLTCYM>F<HMYVGVRAGGGIGDEIEDPAGDEYEIYRII4845
RYR3AFNFFRKFYNKSEDDDEPDMKCDDMMTCYL>F<HMYVGVRAGGGIGDEIEDPAGDPYEMYRIV4748
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F4886Lc.14658T>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Clinical and genetic findings in a large cohort of patients with ryanodine receptor 1 gene-associated myopathies. Hum Mutat. 2012 33(6):981-8. doi: 10.1002/humu.22056. 22473935