Paralogue Annotation for RYR1 residue 4928

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4928
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4928

No paralogue variants have been mapped to residue 4928 for RYR1.



RYR1IGDEIEDPAGDEYELYRVVFDITFFFFVIV>I<LLAIIQGLIIDAFGELRDQQEQVKEDMETK4958
RYR2IGDEIEDPAGDEYEIYRIIFDITFFFFVIV>I<LLAIIQGLIIDAFGELRDQQEQVKEDMETK4887
RYR3IGDEIEDPAGDPYEMYRIVFDITFFFFVIV>I<LLAIIQGLIIDAFGELRDQQEQVREDMETK4790
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I4928Mc.14784C>G Putative BenignSIFT: deleterious
Polyphen: benign