Paralogue Annotation for RYR1 residue 4980

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 4980
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 4980

No paralogue variants have been mapped to residue 4980 for RYR1.



RYR1QVKEDMETKCFICGIGSDYFDTTPHGFETH>T<LEEHNLANYMFFLMYLINKDETEHTGQESY5010
RYR2QVKEDMETKCFICGIGNDYFDTVPHGFETH>T<LQEHNLANYLFFLMYLINKDETEHTGQESY4939
RYR3QVREDMETKCFICGIGNDYFDTTPHGFETH>T<LQEHNLANYLFFLMYLINKDETEHTGQESY4842
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T4980Mc.14939C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Muscle magnetic resonance imaging in congenital myopathies due to ryanodine receptor type 1 gene mutations. Arch Neurol. 2011 68(9):1171-9. 21911697