Paralogue Annotation for RYR1 residue 5020

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 5020
Reference Amino Acid: W - Tryptophan
Protein Domain:


Paralogue Variants mapped to RYR1 residue 5020

No paralogue variants have been mapped to residue 5020 for RYR1.



RYR1MFFLMYLINKDETEHTGQESYVWKMYQERC>W<DFFPAGDCFRKQYEDQLS5038
RYR2LFFLMYLINKDETEHTGQESYVWKMYQERC>W<EFFPAGDCFRKQYEDQLN4967
RYR3LFFLMYLINKDETEHTGQESYVWKMYQERC>W<DFFPAGDCFRKQYEDQLG4870
cons                              > <                  

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.W5020Sc.15059G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Functional and genetic characterization of clinical malignant hyperthermia crises: a multi-centre study. Orphanet J Rare Dis. 2014 9(1):8. doi: 10.1186/1750-1172-9-8. 24433488
p.W5020Cc.15060G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145