Paralogue Annotation for RYR1 residue 530

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 530
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 530

No paralogue variants have been mapped to residue 530 for RYR1.



RYR1AHFAEFAGEEAAESWKEIVNLLYELLASLI>R<GNRSNCALFSTNLDWLVSKLDRLEASSGIL560
RYR2AHFADVAGREAGESWKSILNSLYELLAALI>R<GNRKNCAQFSGSLDWLISRLERLEASSGIL572
RYR3AHFAGIAREESGMAWKEILNLLYKLLAALI>R<GNRNNCAQFSNNLDWLISKLDRLESSSGIL559
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R530Hc.1589G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943
Other Myopathy Functional characterization of ryanodine receptor (RYR1) sequence variants using a metabolic assay in immortalized B-lymphocytes. Hum Mutat. 2009 30(4):E575-90. 19191333
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
p.R530Cc.1588C>T Putative BenignSIFT:
Polyphen:
p.Arg530Leuc.1589G>T UnknownSIFT:
Polyphen: