Paralogue Annotation for RYR1 residue 544

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 544
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 544

No paralogue variants have been mapped to residue 544 for RYR1.



RYR1WKEIVNLLYELLASLIRGNRSNCALFSTNL>D<WLVSKLDRLEASSGILEVLYCVLIESPEVL574
RYR2WKSILNSLYELLAALIRGNRKNCAQFSGSL>D<WLISRLERLEASSGILEVLHCVLVESPEAL586
RYR3WKEILNLLYKLLAALIRGNRNNCAQFSNNL>D<WLISKLDRLESSSGILEVLHCILTESPEAL573
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D544Yc.1630G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Increasing the number of diagnostic mutations in malignant hyperthermia. Hum Mutat. 2009 30(4):590-8. 19191329